Myotis yumanensis (Yuma myotis): 138994453 Help Entry 138994453         CDS       T10762                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04081   Hormone signaling myum04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     138994453 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     138994453 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myum04052]     138994453 (GAST) Cytokines and neuropeptides [BR:myum04052]  Neuropeptides   GPCR binding    138994453 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  138994453 NCBI-ProteinID:  XP_070250496 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVQALILALALAAFSEASWKPRSQLQDAPSGPGAKRAPEAHWPDQLGPAPHHQRQL RFPDPPRPVADLSKKQGPWLEEEEEAYGWMDFGRRSAEEGDQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcggctctgtgtgcaagcgctgatcctggctctggctctggccgccttctcggaa gcctcctggaagccccgctcccagctgcaggacgcaccctccggcccaggggccaagagg gccccggaggcacattggccggaccagctgggcccagcccctcaccaccaaaggcagctg aggttcccggatcccccacgcccggtggcagacctgtccaagaagcaggggccgtggctg gaggaagaggaagaagcctatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacagccctag

DBGET integrated database retrieval system