Myotis yumanensis (Yuma myotis): 138995405 Help Entry 138995405         CDS       T10762                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum01521   EGFR tyrosine kinase inhibitor resistance myum01522   Endocrine resistance myum04010   MAPK signaling pathway myum04012   ErbB signaling pathway myum04014   Ras signaling pathway myum04015   Rap1 signaling pathway myum04062   Chemokine signaling pathway myum04068   FoxO signaling pathway myum04071   Sphingolipid signaling pathway myum04072   Phospholipase D signaling pathway myum04137   Mitophagy - animal myum04140   Autophagy - animal myum04150   mTOR signaling pathway myum04151   PI3K-Akt signaling pathway myum04210   Apoptosis myum04211   Longevity regulating pathway myum04213   Longevity regulating pathway - multiple species myum04218   Cellular senescence myum04360   Axon guidance myum04370   VEGF signaling pathway myum04371   Apelin signaling pathway myum04540   Gap junction myum04550   Signaling pathways regulating pluripotency of stem cells myum04625   C-type lectin receptor signaling pathway myum04650   Natural killer cell mediated cytotoxicity myum04660   T cell receptor signaling pathway myum04662   B cell receptor signaling pathway myum04664   Fc epsilon RI signaling pathway myum04714   Thermogenesis myum04720   Long-term potentiation myum04722   Neurotrophin signaling pathway myum04725   Cholinergic synapse myum04726   Serotonergic synapse myum04730   Long-term depression myum04810   Regulation of actin cytoskeleton myum04910   Insulin signaling pathway myum04912   GnRH signaling pathway myum04915   Estrogen signaling pathway myum04916   Melanogenesis myum04917   Prolactin signaling pathway myum04919   Thyroid hormone signaling pathway myum04921   Oxytocin signaling pathway myum04926   Relaxin signaling pathway myum04929   GnRH secretion myum04933   AGE-RAGE signaling pathway in diabetic complications myum04935   Growth hormone synthesis, secretion and action myum05010   Alzheimer disease myum05022   Pathways of neurodegeneration - multiple diseases myum05034   Alcoholism myum05160   Hepatitis C myum05161   Hepatitis B myum05163   Human cytomegalovirus infection myum05165   Human papillomavirus infection myum05166   Human T-cell leukemia virus 1 infection myum05167   Kaposi sarcoma-associated herpesvirus infection myum05170   Human immunodeficiency virus 1 infection myum05200   Pathways in cancer myum05203   Viral carcinogenesis myum05205   Proteoglycans in cancer myum05206   MicroRNAs in cancer myum05207   Chemical carcinogenesis - receptor activation myum05208   Chemical carcinogenesis - reactive oxygen species myum05210   Colorectal cancer myum05211   Renal cell carcinoma myum05213   Endometrial cancer myum05214   Glioma myum05215   Prostate cancer myum05216   Thyroid cancer myum05218   Melanoma myum05219   Bladder cancer myum05220   Chronic myeloid leukemia myum05221   Acute myeloid leukemia myum05223   Non-small cell lung cancer myum05224   Breast cancer myum05225   Hepatocellular carcinoma myum05226   Gastric cancer myum05230   Central carbon metabolism in cancer myum05231   Choline metabolism in cancer myum05235   PD-L1 expression and PD-1 checkpoint pathway in cancer myum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     138995405 (NRAS)    04012 ErbB signaling pathway     138995405 (NRAS)    04014 Ras signaling pathway     138995405 (NRAS)    04015 Rap1 signaling pathway     138995405 (NRAS)    04370 VEGF signaling pathway     138995405 (NRAS)    04371 Apelin signaling pathway     138995405 (NRAS)    04068 FoxO signaling pathway     138995405 (NRAS)    04072 Phospholipase D signaling pathway     138995405 (NRAS)    04071 Sphingolipid signaling pathway     138995405 (NRAS)    04151 PI3K-Akt signaling pathway     138995405 (NRAS)    04150 mTOR signaling pathway     138995405 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     138995405 (NRAS)    04137 Mitophagy - animal     138995405 (NRAS)   09143 Cell growth and death    04210 Apoptosis     138995405 (NRAS)    04218 Cellular senescence     138995405 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     138995405 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     138995405 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     138995405 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     138995405 (NRAS)    04650 Natural killer cell mediated cytotoxicity     138995405 (NRAS)    04660 T cell receptor signaling pathway     138995405 (NRAS)    04662 B cell receptor signaling pathway     138995405 (NRAS)    04664 Fc epsilon RI signaling pathway     138995405 (NRAS)    04062 Chemokine signaling pathway     138995405 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     138995405 (NRAS)    04929 GnRH secretion     138995405 (NRAS)    04912 GnRH signaling pathway     138995405 (NRAS)    04915 Estrogen signaling pathway     138995405 (NRAS)    04917 Prolactin signaling pathway     138995405 (NRAS)    04921 Oxytocin signaling pathway     138995405 (NRAS)    04926 Relaxin signaling pathway     138995405 (NRAS)    04935 Growth hormone synthesis, secretion and action     138995405 (NRAS)    04919 Thyroid hormone signaling pathway     138995405 (NRAS)    04916 Melanogenesis     138995405 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     138995405 (NRAS)    04726 Serotonergic synapse     138995405 (NRAS)    04720 Long-term potentiation     138995405 (NRAS)    04730 Long-term depression     138995405 (NRAS)    04722 Neurotrophin signaling pathway     138995405 (NRAS)   09158 Development and regeneration    04360 Axon guidance     138995405 (NRAS)   09149 Aging    04211 Longevity regulating pathway     138995405 (NRAS)    04213 Longevity regulating pathway - multiple species     138995405 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     138995405 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     138995405 (NRAS)    05206 MicroRNAs in cancer     138995405 (NRAS)    05205 Proteoglycans in cancer     138995405 (NRAS)    05207 Chemical carcinogenesis - receptor activation     138995405 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     138995405 (NRAS)    05203 Viral carcinogenesis     138995405 (NRAS)    05230 Central carbon metabolism in cancer     138995405 (NRAS)    05231 Choline metabolism in cancer     138995405 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     138995405 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     138995405 (NRAS)    05225 Hepatocellular carcinoma     138995405 (NRAS)    05226 Gastric cancer     138995405 (NRAS)    05214 Glioma     138995405 (NRAS)    05216 Thyroid cancer     138995405 (NRAS)    05221 Acute myeloid leukemia     138995405 (NRAS)    05220 Chronic myeloid leukemia     138995405 (NRAS)    05218 Melanoma     138995405 (NRAS)    05211 Renal cell carcinoma     138995405 (NRAS)    05219 Bladder cancer     138995405 (NRAS)    05215 Prostate cancer     138995405 (NRAS)    05213 Endometrial cancer     138995405 (NRAS)    05224 Breast cancer     138995405 (NRAS)    05223 Non-small cell lung cancer     138995405 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     138995405 (NRAS)    05170 Human immunodeficiency virus 1 infection     138995405 (NRAS)    05161 Hepatitis B     138995405 (NRAS)    05160 Hepatitis C     138995405 (NRAS)    05163 Human cytomegalovirus infection     138995405 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     138995405 (NRAS)    05165 Human papillomavirus infection     138995405 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     138995405 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     138995405 (NRAS)   09165 Substance dependence    05034 Alcoholism     138995405 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138995405 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     138995405 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     138995405 (NRAS)    01522 Endocrine resistance     138995405 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myum04131]     138995405 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myum04147]     138995405 (NRAS)    04031 GTP-binding proteins [BR:myum04031]     138995405 (NRAS) Membrane trafficking [BR:myum04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     138995405 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     138995405 (NRAS) Exosome [BR:myum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138995405 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    138995405 (NRAS)   Exosomal proteins of breast cancer cells    138995405 (NRAS)   Exosomal proteins of colorectal cancer cells    138995405 (NRAS) GTP-binding proteins [BR:myum04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     138995405 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  138995405 NCBI-ProteinID:  XP_070251906 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctattggatatactggatacagctgga caagaggagtacagtgctatgagggaccaatacatgaggacaggggaaggcttcctctgt gtattcgccatcaataatagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagtgaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactagta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system