Myotis yumanensis (Yuma myotis): 138995453 Help Entry 138995453         CDS       T10762                                  Symbol H2AC21 Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum03082   ATP-dependent chromatin remodeling myum04217   Necroptosis myum04613   Neutrophil extracellular trap formation myum05034   Alcoholism myum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:myum00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     138995453 (H2AC21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138995453 (H2AC21)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     138995453 (H2AC21)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     138995453 (H2AC21)   09165 Substance dependence    05034 Alcoholism     138995453 (H2AC21)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myum03036]     138995453 (H2AC21)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myum04147]     138995453 (H2AC21) Chromosome and associated proteins [BR:myum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138995453 (H2AC21) Exosome [BR:myum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138995453 (H2AC21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  138995453 NCBI-ProteinID:  XP_070252015 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcggaaaacagggaggcaaggcccgcgctaaggccaagtcccgctcgtcc cgcgcgggcctgcagttcccggtgggccgcgtgcaccggctgctgcgcaagggcaactac gccgagcgggtgggggccggcgcgcccgtctacatggcggcggtgctggagtacctgacg gctgagatcctggagctggcgggcaacgcggcccgagacaacaagaagacgcgcatcatc ccccgccatttgcaactggccgtgagaaatgacgaagagctcaacaagttacttgggggt gttaccattgcccaaggcggcgtcttacccaatatccaggccgtcttgttgcccaagaaa acggagagtcataagcctggcaaaaacaagtaa

DBGET integrated database retrieval system