Myotis yumanensis (Yuma myotis): 138997810 Help Entry 138997810         CDS       T10762                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04613   Neutrophil extracellular trap formation myum05034   Alcoholism myum05202   Transcriptional misregulation in cancer myum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:myum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     138997810  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     138997810   09163 Immune disease    05322 Systemic lupus erythematosus     138997810   09165 Substance dependence    05034 Alcoholism     138997810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myum03036]     138997810   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myum04147]     138997810 Chromosome and associated proteins [BR:myum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138997810 Exosome [BR:myum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138997810 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  138997810 NCBI-ProteinID:  XP_070255791 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagaccgcccgcaagtcgaccgggggcaaagcgcctcggaagcag ctggcgaccaaagccgctcggaagagtgcgccctccaccggaggggtgaagaagccgcat cgctacaggcccggtaccgtggcacttcgtgaaattagacgttatcagaagtccactgag ctgctcattcgcaagcttcccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagcgcggccattggtgctttgcaggaggcaagtgaggcctat ctggttggcctgttcgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system