KEGG   Myotis yumanensis (Yuma myotis): 138997965
Entry
138997965         CDS       T10762                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
myum  Myotis yumanensis (Yuma myotis)
Pathway
myum01521  EGFR tyrosine kinase inhibitor resistance
myum01522  Endocrine resistance
myum01524  Platinum drug resistance
myum04010  MAPK signaling pathway
myum04012  ErbB signaling pathway
myum04014  Ras signaling pathway
myum04015  Rap1 signaling pathway
myum04022  cGMP-PKG signaling pathway
myum04024  cAMP signaling pathway
myum04062  Chemokine signaling pathway
myum04066  HIF-1 signaling pathway
myum04068  FoxO signaling pathway
myum04071  Sphingolipid signaling pathway
myum04072  Phospholipase D signaling pathway
myum04114  Oocyte meiosis
myum04140  Autophagy - animal
myum04148  Efferocytosis
myum04150  mTOR signaling pathway
myum04151  PI3K-Akt signaling pathway
myum04210  Apoptosis
myum04218  Cellular senescence
myum04261  Adrenergic signaling in cardiomyocytes
myum04270  Vascular smooth muscle contraction
myum04350  TGF-beta signaling pathway
myum04360  Axon guidance
myum04370  VEGF signaling pathway
myum04371  Apelin signaling pathway
myum04380  Osteoclast differentiation
myum04510  Focal adhesion
myum04517  IgSF CAM signaling
myum04520  Adherens junction
myum04540  Gap junction
myum04550  Signaling pathways regulating pluripotency of stem cells
myum04611  Platelet activation
myum04613  Neutrophil extracellular trap formation
myum04620  Toll-like receptor signaling pathway
myum04621  NOD-like receptor signaling pathway
myum04625  C-type lectin receptor signaling pathway
myum04650  Natural killer cell mediated cytotoxicity
myum04657  IL-17 signaling pathway
myum04658  Th1 and Th2 cell differentiation
myum04659  Th17 cell differentiation
myum04660  T cell receptor signaling pathway
myum04662  B cell receptor signaling pathway
myum04664  Fc epsilon RI signaling pathway
myum04666  Fc gamma R-mediated phagocytosis
myum04668  TNF signaling pathway
myum04713  Circadian entrainment
myum04720  Long-term potentiation
myum04722  Neurotrophin signaling pathway
myum04723  Retrograde endocannabinoid signaling
myum04724  Glutamatergic synapse
myum04725  Cholinergic synapse
myum04726  Serotonergic synapse
myum04730  Long-term depression
myum04810  Regulation of actin cytoskeleton
myum04910  Insulin signaling pathway
myum04912  GnRH signaling pathway
myum04914  Progesterone-mediated oocyte maturation
myum04915  Estrogen signaling pathway
myum04916  Melanogenesis
myum04917  Prolactin signaling pathway
myum04919  Thyroid hormone signaling pathway
myum04921  Oxytocin signaling pathway
myum04926  Relaxin signaling pathway
myum04928  Parathyroid hormone synthesis, secretion and action
myum04929  GnRH secretion
myum04930  Type II diabetes mellitus
myum04933  AGE-RAGE signaling pathway in diabetic complications
myum04934  Cushing syndrome
myum04935  Growth hormone synthesis, secretion and action
myum04960  Aldosterone-regulated sodium reabsorption
myum05010  Alzheimer disease
myum05020  Prion disease
myum05022  Pathways of neurodegeneration - multiple diseases
myum05034  Alcoholism
myum05132  Salmonella infection
myum05133  Pertussis
myum05135  Yersinia infection
myum05140  Leishmaniasis
myum05142  Chagas disease
myum05145  Toxoplasmosis
myum05152  Tuberculosis
myum05160  Hepatitis C
myum05161  Hepatitis B
myum05163  Human cytomegalovirus infection
myum05164  Influenza A
myum05165  Human papillomavirus infection
myum05166  Human T-cell leukemia virus 1 infection
myum05167  Kaposi sarcoma-associated herpesvirus infection
myum05170  Human immunodeficiency virus 1 infection
myum05171  Coronavirus disease - COVID-19
myum05200  Pathways in cancer
myum05203  Viral carcinogenesis
myum05205  Proteoglycans in cancer
myum05206  MicroRNAs in cancer
myum05207  Chemical carcinogenesis - receptor activation
myum05208  Chemical carcinogenesis - reactive oxygen species
myum05210  Colorectal cancer
myum05211  Renal cell carcinoma
myum05212  Pancreatic cancer
myum05213  Endometrial cancer
myum05214  Glioma
myum05215  Prostate cancer
myum05216  Thyroid cancer
myum05218  Melanoma
myum05219  Bladder cancer
myum05220  Chronic myeloid leukemia
myum05221  Acute myeloid leukemia
myum05223  Non-small cell lung cancer
myum05224  Breast cancer
myum05225  Hepatocellular carcinoma
myum05226  Gastric cancer
myum05230  Central carbon metabolism in cancer
myum05231  Choline metabolism in cancer
myum05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myum05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    138997965 (MAPK1)
   04012 ErbB signaling pathway
    138997965 (MAPK1)
   04014 Ras signaling pathway
    138997965 (MAPK1)
   04015 Rap1 signaling pathway
    138997965 (MAPK1)
   04350 TGF-beta signaling pathway
    138997965 (MAPK1)
   04370 VEGF signaling pathway
    138997965 (MAPK1)
   04371 Apelin signaling pathway
    138997965 (MAPK1)
   04668 TNF signaling pathway
    138997965 (MAPK1)
   04066 HIF-1 signaling pathway
    138997965 (MAPK1)
   04068 FoxO signaling pathway
    138997965 (MAPK1)
   04072 Phospholipase D signaling pathway
    138997965 (MAPK1)
   04071 Sphingolipid signaling pathway
    138997965 (MAPK1)
   04024 cAMP signaling pathway
    138997965 (MAPK1)
   04022 cGMP-PKG signaling pathway
    138997965 (MAPK1)
   04151 PI3K-Akt signaling pathway
    138997965 (MAPK1)
   04150 mTOR signaling pathway
    138997965 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    138997965 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    138997965 (MAPK1)
   04148 Efferocytosis
    138997965 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    138997965 (MAPK1)
   04210 Apoptosis
    138997965 (MAPK1)
   04218 Cellular senescence
    138997965 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    138997965 (MAPK1)
   04520 Adherens junction
    138997965 (MAPK1)
   04540 Gap junction
    138997965 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    138997965 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    138997965 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    138997965 (MAPK1)
   04613 Neutrophil extracellular trap formation
    138997965 (MAPK1)
   04620 Toll-like receptor signaling pathway
    138997965 (MAPK1)
   04621 NOD-like receptor signaling pathway
    138997965 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    138997965 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    138997965 (MAPK1)
   04660 T cell receptor signaling pathway
    138997965 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    138997965 (MAPK1)
   04659 Th17 cell differentiation
    138997965 (MAPK1)
   04657 IL-17 signaling pathway
    138997965 (MAPK1)
   04662 B cell receptor signaling pathway
    138997965 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    138997965 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    138997965 (MAPK1)
   04062 Chemokine signaling pathway
    138997965 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    138997965 (MAPK1)
   04929 GnRH secretion
    138997965 (MAPK1)
   04912 GnRH signaling pathway
    138997965 (MAPK1)
   04915 Estrogen signaling pathway
    138997965 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    138997965 (MAPK1)
   04917 Prolactin signaling pathway
    138997965 (MAPK1)
   04921 Oxytocin signaling pathway
    138997965 (MAPK1)
   04926 Relaxin signaling pathway
    138997965 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    138997965 (MAPK1)
   04919 Thyroid hormone signaling pathway
    138997965 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    138997965 (MAPK1)
   04916 Melanogenesis
    138997965 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    138997965 (MAPK1)
   04270 Vascular smooth muscle contraction
    138997965 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    138997965 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    138997965 (MAPK1)
   04725 Cholinergic synapse
    138997965 (MAPK1)
   04726 Serotonergic synapse
    138997965 (MAPK1)
   04720 Long-term potentiation
    138997965 (MAPK1)
   04730 Long-term depression
    138997965 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    138997965 (MAPK1)
   04722 Neurotrophin signaling pathway
    138997965 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    138997965 (MAPK1)
   04380 Osteoclast differentiation
    138997965 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    138997965 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138997965 (MAPK1)
   05206 MicroRNAs in cancer
    138997965 (MAPK1)
   05205 Proteoglycans in cancer
    138997965 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    138997965 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    138997965 (MAPK1)
   05203 Viral carcinogenesis
    138997965 (MAPK1)
   05230 Central carbon metabolism in cancer
    138997965 (MAPK1)
   05231 Choline metabolism in cancer
    138997965 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    138997965 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    138997965 (MAPK1)
   05212 Pancreatic cancer
    138997965 (MAPK1)
   05225 Hepatocellular carcinoma
    138997965 (MAPK1)
   05226 Gastric cancer
    138997965 (MAPK1)
   05214 Glioma
    138997965 (MAPK1)
   05216 Thyroid cancer
    138997965 (MAPK1)
   05221 Acute myeloid leukemia
    138997965 (MAPK1)
   05220 Chronic myeloid leukemia
    138997965 (MAPK1)
   05218 Melanoma
    138997965 (MAPK1)
   05211 Renal cell carcinoma
    138997965 (MAPK1)
   05219 Bladder cancer
    138997965 (MAPK1)
   05215 Prostate cancer
    138997965 (MAPK1)
   05213 Endometrial cancer
    138997965 (MAPK1)
   05224 Breast cancer
    138997965 (MAPK1)
   05223 Non-small cell lung cancer
    138997965 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    138997965 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    138997965 (MAPK1)
   05161 Hepatitis B
    138997965 (MAPK1)
   05160 Hepatitis C
    138997965 (MAPK1)
   05171 Coronavirus disease - COVID-19
    138997965 (MAPK1)
   05164 Influenza A
    138997965 (MAPK1)
   05163 Human cytomegalovirus infection
    138997965 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    138997965 (MAPK1)
   05165 Human papillomavirus infection
    138997965 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    138997965 (MAPK1)
   05135 Yersinia infection
    138997965 (MAPK1)
   05133 Pertussis
    138997965 (MAPK1)
   05152 Tuberculosis
    138997965 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    138997965 (MAPK1)
   05140 Leishmaniasis
    138997965 (MAPK1)
   05142 Chagas disease
    138997965 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138997965 (MAPK1)
   05020 Prion disease
    138997965 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    138997965 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    138997965 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138997965 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    138997965 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    138997965 (MAPK1)
   04934 Cushing syndrome
    138997965 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    138997965 (MAPK1)
   01524 Platinum drug resistance
    138997965 (MAPK1)
   01522 Endocrine resistance
    138997965 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myum01001]
    138997965 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myum03036]
    138997965 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myum04147]
    138997965 (MAPK1)
Enzymes [BR:myum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     138997965 (MAPK1)
Protein kinases [BR:myum01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   138997965 (MAPK1)
Chromosome and associated proteins [BR:myum03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     138997965 (MAPK1)
Exosome [BR:myum04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   138997965 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 138997965
NCBI-ProteinID: XP_070256060
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacattggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcctactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcgccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgattttggcttggcccgcgttgcagatccagaccatgatcac
acagggttcctgacagagtatgtagccacacgttggtacagggctccagaaattatgttg
aattccaagggctatacaaagtccattgatatttggtctgtaggctgcattctggcagag
atgctctccaacaggcccatcttcccagggaagcattaccttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgcataatcaacctaaaagct
agaaactatttgctttctctcccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgattccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaag
aggattgaagtagaacaggcgctagcccacccgtatctggagcagtattatgacccaagt
gatgagcccattgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gagaagctcaaagaactcatttttgaagagaccgctagattccagcctggatatagatct
taa

DBGET integrated database retrieval system