Myotis yumanensis (Yuma myotis): 139000590 Help Entry 139000590         CDS       T10762                                  Symbol CLDN34 Name (RefSeq) claudin-34   KO K06087   claudin Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum03272   Virion - Hepatitis viruses myum04382   Cornified envelope formation myum04514   Cell adhesion molecule (CAM) interaction myum04530   Tight junction myum04670   Leukocyte transendothelial migration myum05160   Hepatitis C Brite KEGG Orthology (KO) [BR:myum00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     139000590 (CLDN34)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     139000590 (CLDN34)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     139000590 (CLDN34)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     139000590 (CLDN34)   09158 Development and regeneration    04382 Cornified envelope formation     139000590 (CLDN34)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     139000590 (CLDN34)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myum03037]     139000590 (CLDN34)    04147 Exosome [BR:myum04147]     139000590 (CLDN34) Cilium and associated proteins [BR:myum03037]  Other cilia and associated proteins   Stereociliary proteins    139000590 (CLDN34) Exosome [BR:myum04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    139000590 (CLDN34)   Exosomal proteins of colorectal cancer cells    139000590 (CLDN34) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Claudin_2 PMP22_Claudin TMEM_230_134 MARVEL DUF308 Motif Other DBs NCBI-GeneID:  139000590 NCBI-ProteinID:  XP_070258834 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MTCMGLAEWRVWYVDNSSTSFPGLACIGMWKVCTYQPTSLHSRPISCHRYTYSDTYLPLD IRIAQNLLLAASLLGLLGKVLMVMGLWRVYVGKRQGDDTCNLLFACGVLSITAGAFILIA VTWNYHSVMNEEGIRFPPSFHIPFKPDRQEIGSTVPVAVLAAFLMLLSGLLTISFQRSPN SQVYPEVSQV NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgacttgcatgggcctggccgagtggcgggtgtggtacgtggacaacagctccacctcc ttcccggggctggcctgcatagggatgtggaaggtctgcacttaccagcccaccagcctc cacagcagacccatctcgtgtcaccgctacacctacagtgacacctacctgccgctcgat atccgcatcgctcagaaccttctgctggccgccagcctgctcggactcctggggaaagtg ctcatggtcatgggcctgtggagagtgtacgtgggaaagcgtcagggtgacgacacctgc aatctgttattcgcttgcggtgtcctgagcatcacagcgggcgcatttatcctcattgct gtgacctggaactaccactccgtgatgaatgaagagggcatacgcttcccgccatccttc cacatccccttcaagccagaccggcaggagatcggtagcaccgtgccagtggcagttttg gctgccttcctcatgctgttgagtgggctgcttaccatctctttccagcggtccccgaac agccaagtgtaccccgaggtctcacaagtgtga

DBGET integrated database retrieval system