Myotis yumanensis (Yuma myotis): 139011074 Help Entry 139011074         CDS       T10762                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04140   Autophagy - animal myum04144   Endocytosis myum04152   AMPK signaling pathway myum04530   Tight junction myum04972   Pancreatic secretion myum05014   Amyotrophic lateral sclerosis myum05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     139011074 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     139011074 (RAB8A)    04140 Autophagy - animal     139011074 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     139011074 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     139011074 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     139011074 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     139011074 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myum04131]     139011074 (RAB8A)    03036 Chromosome and associated proteins [BR:myum03036]     139011074 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myum04147]     139011074 (RAB8A)    04031 GTP-binding proteins [BR:myum04031]     139011074 (RAB8A) Membrane trafficking [BR:myum04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     139011074 (RAB8A)  Autophagy   Other autophagy associated proteins     139011074 (RAB8A) Chromosome and associated proteins [BR:myum03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     139011074 (RAB8A) Exosome [BR:myum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139011074 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    139011074 (RAB8A)   Exosomal proteins of colorectal cancer cells    139011074 (RAB8A) GTP-binding proteins [BR:myum04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     139011074 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  139011074 NCBI-ProteinID:  XP_070272397 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKKTSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactacag atatgggacacagctggccaggaacggtttcggacgatcacaacagcttactacaggggc gcgatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgacaacatccgg aactggattcggaacattgaggagcatgcctctgcagatgttgaaaagatgatacttgga aacaagtgtgacgtgaacgacaagagacaagtctccaaggaacggggagagaagctggcc ctggactatggaatcaagttcatggagaccagtgcaaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaaaaagaccagc ttttttcgatgtgttcttctgtga

DBGET integrated database retrieval system