Myotis yumanensis (Yuma myotis): 139011695 Help Entry 139011695         CDS       T10762                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04015   Rap1 signaling pathway myum04810   Regulation of actin cytoskeleton myum05014   Amyotrophic lateral sclerosis myum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     139011695 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     139011695 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     139011695 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     139011695 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myum04131]     139011695 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myum04812]     139011695 (PFN3)    04147 Exosome [BR:myum04147]     139011695 (PFN3) Membrane trafficking [BR:myum04131]  Others   Actin-binding proteins    Others     139011695 (PFN3) Cytoskeleton proteins [BR:myum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      139011695 (PFN3) Exosome [BR:myum04147]  Exosomal proteins   Proteins found in most exosomes    139011695 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  139011695 NCBI-ProteinID:  XP_070273289 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGEWKAYISAVLQDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGQDRCTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKKVHELIHWLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgagtggaaagcctacatcagtgcggtgctgcaggaccagcgcatcgacgacgta gccatcgtgggccattcggacaatcgctgtgtgtgggcatcgcggcccgggggactgctg gccgccatctcgccgcaggaggtgggtgtgctcacggggcaggaccggtgcaccttcctg caggcgggcctgagcgtggcgggccgccgctgctgcgtcatcagagaccacctgctggcg gagggcgacggcgtgctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtg ggccacacgccgcgcgcgcttctggtgctcatgggccggcggggcgtgcacgggggcatc ctcaacaagaaggtgcacgagctgatccactggctgcgcactcagggcacctag

DBGET integrated database retrieval system