Myotis yumanensis (Yuma myotis): 139012706 Help Entry 139012706         CDS       T10762                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum03008   Ribosome biogenesis in eukaryotes myum03083   Polycomb repressive complex myum04064   NF-kappa B signaling pathway myum04137   Mitophagy - animal myum04310   Wnt signaling pathway myum04520   Adherens junction myum05010   Alzheimer disease myum05020   Prion disease myum05022   Pathways of neurodegeneration - multiple diseases myum05162   Measles myum05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:myum00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     139012706 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     139012706 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     139012706 (CSNK2B)    04064 NF-kappa B signaling pathway     139012706 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     139012706 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     139012706 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     139012706 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     139012706 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     139012706 (CSNK2B)    05020 Prion disease     139012706 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     139012706 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:myum03009]     139012706 (CSNK2B)    03036 Chromosome and associated proteins [BR:myum03036]     139012706 (CSNK2B) Ribosome biogenesis [BR:myum03009]  Eukaryotic type   90S particles    Kinase     139012706 (CSNK2B) Chromosome and associated proteins [BR:myum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      139012706 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  139012706 NCBI-ProteinID:  XP_070275012 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatctcctggttctgtgggctccgtggcaatgag ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactgggctcaac gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagctgagatgctgtat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaaa taccagcagggagactttggctactgtccacgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggggaggccatggtgaagctctactgtcccaagtgc atggacgtgtacacacccaagtcctcgaggcaccaccacacggacggcgcgtacttcggc actggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcctgcc aaccagtttgtgcccaggctctatggtttcaagatccatccgatggcctaccagctgcag ctccaagccgctagcaacttcaagagcccagtcaagacgatccgctga

DBGET integrated database retrieval system