Myotis yumanensis (Yuma myotis): 139018949 Help Entry 139018949         CDS       T10762                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04024   cAMP signaling pathway myum04062   Chemokine signaling pathway myum04064   NF-kappa B signaling pathway myum04210   Apoptosis myum04380   Osteoclast differentiation myum04620   Toll-like receptor signaling pathway myum04621   NOD-like receptor signaling pathway myum04622   RIG-I-like receptor signaling pathway myum04623   Cytosolic DNA-sensing pathway myum04625   C-type lectin receptor signaling pathway myum04657   IL-17 signaling pathway myum04658   Th1 and Th2 cell differentiation myum04659   Th17 cell differentiation myum04660   T cell receptor signaling pathway myum04662   B cell receptor signaling pathway myum04668   TNF signaling pathway myum04722   Neurotrophin signaling pathway myum04920   Adipocytokine signaling pathway myum04926   Relaxin signaling pathway myum04931   Insulin resistance myum04936   Alcoholic liver disease myum05132   Salmonella infection myum05134   Legionellosis myum05135   Yersinia infection myum05140   Leishmaniasis myum05142   Chagas disease myum05145   Toxoplasmosis myum05160   Hepatitis C myum05161   Hepatitis B myum05162   Measles myum05163   Human cytomegalovirus infection myum05164   Influenza A myum05166   Human T-cell leukemia virus 1 infection myum05167   Kaposi sarcoma-associated herpesvirus infection myum05168   Herpes simplex virus 1 infection myum05169   Epstein-Barr virus infection myum05170   Human immunodeficiency virus 1 infection myum05171   Coronavirus disease - COVID-19 myum05200   Pathways in cancer myum05203   Viral carcinogenesis myum05208   Chemical carcinogenesis - reactive oxygen species myum05215   Prostate cancer myum05220   Chronic myeloid leukemia myum05222   Small cell lung cancer myum05235   PD-L1 expression and PD-1 checkpoint pathway in cancer myum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     139018949 (NFKBIA)    04668 TNF signaling pathway     139018949 (NFKBIA)    04024 cAMP signaling pathway     139018949 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     139018949 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     139018949 (NFKBIA)    04621 NOD-like receptor signaling pathway     139018949 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     139018949 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     139018949 (NFKBIA)    04625 C-type lectin receptor signaling pathway     139018949 (NFKBIA)    04660 T cell receptor signaling pathway     139018949 (NFKBIA)    04658 Th1 and Th2 cell differentiation     139018949 (NFKBIA)    04659 Th17 cell differentiation     139018949 (NFKBIA)    04657 IL-17 signaling pathway     139018949 (NFKBIA)    04662 B cell receptor signaling pathway     139018949 (NFKBIA)    04062 Chemokine signaling pathway     139018949 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     139018949 (NFKBIA)    04926 Relaxin signaling pathway     139018949 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     139018949 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     139018949 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     139018949 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     139018949 (NFKBIA)    05203 Viral carcinogenesis     139018949 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     139018949 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     139018949 (NFKBIA)    05215 Prostate cancer     139018949 (NFKBIA)    05222 Small cell lung cancer     139018949 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     139018949 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     139018949 (NFKBIA)    05161 Hepatitis B     139018949 (NFKBIA)    05160 Hepatitis C     139018949 (NFKBIA)    05171 Coronavirus disease - COVID-19     139018949 (NFKBIA)    05164 Influenza A     139018949 (NFKBIA)    05162 Measles     139018949 (NFKBIA)    05168 Herpes simplex virus 1 infection     139018949 (NFKBIA)    05163 Human cytomegalovirus infection     139018949 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     139018949 (NFKBIA)    05169 Epstein-Barr virus infection     139018949 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     139018949 (NFKBIA)    05135 Yersinia infection     139018949 (NFKBIA)    05134 Legionellosis     139018949 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     139018949 (NFKBIA)    05140 Leishmaniasis     139018949 (NFKBIA)    05142 Chagas disease     139018949 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     139018949 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     139018949 (NFKBIA)    04931 Insulin resistance     139018949 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:myum03000]     139018949 (NFKBIA)    04131 Membrane trafficking [BR:myum04131]     139018949 (NFKBIA) Transcription factors [BR:myum03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     139018949 (NFKBIA) Membrane trafficking [BR:myum04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     139018949 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  139018949 NCBI-ProteinID:  XP_070284127 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFHPAERAQDWAMEGPRDGLKKERPLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RSSEPWKQQLTEDGDSFLHLAIIHEERALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAQALLEAGCDPELRDFRGNTPLHLACEQGSLASVGVLTQSCGTQHLQAILQATN YNGHTCLHLASIHGYLGIVERLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaccccgccgagcgcgcccaggactgggccatggagggcccccgggacgggctc aagaaggagcggccgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaagcgccg cgcagctccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gccatcatccatgaagagcgggcgctgactatggaagtggtccgccaagtgaagggagac ctggcctttcttaacttccagaacaacctgcagcagactccgctccacttggctgtgatc accaaccagccagaaatcgcccaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggcagcctggccagtgtg ggagtcctgactcagagctgtgggacccagcacctccaggccatcctgcaggccaccaac tacaatggccacacatgtctgcacttagcctccatccatggctacctgggcatcgtggag cgtttggtgtccttgggcgctgatgtcaatgcccaggagccctgtaatggccgaacggcc cttcatcttgcggtggatctgcagaatcccgacctggtgtcgctcctgctgaagtgtggg gctgacgtcaacagagtcacctaccagggctactccccgtaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcggagttcacagaggatgagctg ccctacgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system