Myotis yumanensis (Yuma myotis): 139019391 Help Entry 139019391         CDS       T10762                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04015   Rap1 signaling pathway myum04810   Regulation of actin cytoskeleton myum05014   Amyotrophic lateral sclerosis myum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     139019391 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     139019391 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     139019391 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     139019391 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myum04131]     139019391 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myum04812]     139019391 (PFN4)    04147 Exosome [BR:myum04147]     139019391 (PFN4) Membrane trafficking [BR:myum04131]  Others   Actin-binding proteins    Others     139019391 (PFN4) Cytoskeleton proteins [BR:myum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      139019391 (PFN4) Exosome [BR:myum04147]  Exosomal proteins   Proteins found in most exosomes    139019391 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  139019391 NCBI-ProteinID:  XP_070284511 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MSHLQNLLLDSLLGTKHVDSAALIQLQERSLCVASPGFTVMPSDIRTLVNGFAKNPLQAR REGLYFMDKDYKCVRADEYSLYAKYENTGVIVVKTGLYLLVATYTEGMYPSVCVEATEKL GKCVSQGLSLLPMVVESPDCK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagattccctcctgggcaccaagcatgtggacagc gcggccctcatccaactccaggagcggagcctgtgtgtagcatcaccagggtttactgtg atgcccagtgacatccggacacttgtgaatggattcgccaagaaccctctgcaagcccga agagaaggactgtatttcatggacaaggactacaaatgtgtccgggcagatgagtattct ctttatgctaagtatgaaaacaccggtgtgattgtcgtgaagacgggtctgtatctcctg gtggcgacgtacactgagggcatgtatcccagtgtttgtgtggaagccacggagaagctg ggtaagtgtgtctcccagggcctgtctttgctccctatggtagtcgagtctcctgactgc aagtga

DBGET integrated database retrieval system