Mycobacterium sp. MS1601: BVC93_12940 Help Entry BVC93_12940       CDS       T10274                                  Name (GenBank) hypothetical protein   KO K15763   toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-] Organism myw  Mycobacterium sp. MS1601 Pathway myw00623   Toluene degradation myw01100   Metabolic pathways myw01120   Microbial metabolism in diverse environments myw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:myw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00623 Toluene degradation     BVC93_12940 Enzymes [BR:myw01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.236  toluene 4-monooxygenase      BVC93_12940 SSDB OrthologParalogGFIT Motif Pfam:  MmoB_DmpM REXO3_N Motif Other DBs NCBI-ProteinID:  AQA03176 LinkDB All DBs Position 2644165..2644455 Genome browser AA seq 96 aa AA seqDB search MNAAESVGPVLHATPFARKVIAAIQDENEQVTVQDEGAYIRVLSPRICRLSRVGLEAATG VNVRFPGELEVVMSSFTGAMRLTEDDAIWQLAEDPW NT seq 291 nt NT seq  +upstreamnt  +downstreamnt gtgaatgcggccgagagcgtcggtccggtcctgcatgcaacaccgttcgcacgcaaggtg attgcggctatccaggacgagaacgaacaggtgaccgtacaggacgagggggcttacata cgcgtgctgtcgcctcgaatctgccggctgtcgcgggtcgggctcgaggcagcgacaggg gtgaacgtccgatttcctggggagttggaggtggtgatgtcgtcgttcacgggtgccatg cggctgaccgaggatgatgcgatctggcaactcgcggaggatccgtggtga

DBGET integrated database retrieval system