Mycobacterium sp. MS1601: BVC93_20495 Help Entry BVC93_20495       CDS       T10274                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism myw  Mycobacterium sp. MS1601 Pathway myw01100   Metabolic pathways myw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:myw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BVC93_20495    00074 Mycolic acid biosynthesis     BVC93_20495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BVC93_20495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AQA04404 LinkDB All DBs Position complement(4209925..4210194) Genome browser AA seq 89 aa AA seqDB search MEPSSRPTISAELTEILCEDLRIDVSRIRRESRLISDVCLDWIGFAIAVVAIEDKLRIHL SEQDLLSINTIGDLDDILHVQHLIESLSA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggagccgtcatcacgaccaaccatcagcgcagagctcaccgaaattctctgcgaggac ctgcgtatcgacgtttcccggatccgccgggagtctcggctgatcagtgacgtctgcctg gattggatcggcttcgccatcgccgtggtggccatcgaggacaagctgcggattcacctg agcgaacaggatcttttgagtatcaacaccatcggcgatctcgacgacatcctgcatgtg cagcacctgatcgaatcactgtcggcgtga

DBGET integrated database retrieval system