Myxococcus sp. MxC21-1: QEG98_26600 Help Entry QEG98_26600       CDS       T09754                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism myx  Myxococcus sp. MxC21-1 Brite KEGG Orthology (KO) [BR:myx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:myx03110]     QEG98_26600 (grxC) Chaperones and folding catalysts [BR:myx03110]  Protein folding catalysts   Protein disulfide isomerase    QEG98_26600 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like SH3BGR GST_N_3 GST_N_2 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  WNZ59602 UniProt:  A0AA96XDZ2 LinkDB All DBs Position 5974866..5975123 Genome browser AA seq 85 aa AA seqDB search MKPVKIFTTTYCGYCVRAKDLLKRKGVDFEEVDVTGDDDLRAKLVEMSGGQRTVPQIFIG DTHVGGYSDLSRLDTEGRLEPMLQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaagcccgtgaagatttttacgaccacctactgtggctactgcgtccgcgccaaggac ctgctcaagcgcaagggcgtggatttcgaagaggtggacgtcaccggagacgacgacctg cgcgcgaagctcgtggagatgagcggtggccagcgcaccgtgccgcaaatcttcattggc gacacgcacgtcggcggctactccgacttgtcccgcctggacaccgagggccgcctggag ccgatgctccaggcctga

DBGET integrated database retrieval system