Myroides sp. ZB35: BK054_09670 Help Entry BK054_09670       CDS       T04543                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism myz  Myroides sp. ZB35 Brite KEGG Orthology (KO) [BR:myz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:myz03032]     BK054_09670    03036 Chromosome and associated proteins [BR:myz03036]     BK054_09670    03400 DNA repair and recombination proteins [BR:myz03400]     BK054_09670 DNA replication proteins [BR:myz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BK054_09670 Chromosome and associated proteins [BR:myz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BK054_09670 DNA repair and recombination proteins [BR:myz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BK054_09670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg DUF6927 Motif Other DBs NCBI-ProteinID:  APA92477 UniProt:  A0AAC9NG61 LinkDB All DBs Position complement(2135614..2135898) Genome browser AA seq 94 aa AA seqDB search MNKTELIDAIAKDAEISKVAAKKALESFLSNVETTLGKGGKISLVGFGSWSVSERAAREG RNPQTGKTIKIAAKNVVKFKAGSELENAVNKKKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgaattaattgatgcaattgctaaagatgcagagatcagcaaagtggct gctaaaaaagcattagaatcattcttatcaaatgttgaaactactttaggtaaaggtgga aaaatttctttagttggttttggatcttggtcagtatctgaaagagctgctagagaagga agaaaccctcaaactgggaaaacaatcaaaattgctgctaaaaatgtagtaaaatttaaa gctggttctgaattagaaaacgctgtaaacaagaagaaaaaataa

DBGET integrated database retrieval system