Maylandia zebra (zebra mbuna): 101464029 Help Entry 101464029         CDS       T02814                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism mze  Maylandia zebra (zebra mbuna) Pathway mze03082   ATP-dependent chromatin remodeling mze04217   Necroptosis Brite KEGG Orthology (KO) [BR:mze00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101464029  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101464029  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mze03036]     101464029   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mze04147]     101464029 Chromosome and associated proteins [BR:mze03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101464029 Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101464029 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101464029 NCBI-ProteinID:  XP_004574969 LinkDB All DBs Position LG10:complement(4617505..4618364) Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPTKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaggaaagaccggaggcaaagcccgagcaaaggccaagtcccgctcctct cgagccggactccagttcccggtgggtcgagtccacaggctgctgcgcaaaggaaactac gcggagcgggtcggcgccggggctcccgtgtaccttgcggccgtgctggagtatctgact gctgagatcctggagctcgcagggaatgcggccagggacaacaagaagaccagaatcatt ccccggcacctccagctggcagtacgaaacgacgaggagctcaacaagctgctgggggga gtgaccatcgcccaaggaggagtgctgcccaacattcaggctgtcctccttcccaagaag acggagaaaccgaccaagagcaagtaa

DBGET integrated database retrieval system