Maylandia zebra (zebra mbuna): 101468246 Help Entry 101468246         CDS       T02814                                  Name (RefSeq) permeability factor 2 isoform X1   KO K10030   interleukin 8 Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04060   Cytokine-cytokine receptor interaction mze04218   Cellular senescence mze04620   Toll-like receptor signaling pathway mze04621   NOD-like receptor signaling pathway mze04622   RIG-I-like receptor signaling pathway mze05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mze00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101468246  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     101468246  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101468246    04621 NOD-like receptor signaling pathway     101468246    04622 RIG-I-like receptor signaling pathway     101468246  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101468246  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mze04052]     101468246    00536 Glycosaminoglycan binding proteins [BR:mze00536]     101468246 Cytokines and neuropeptides [BR:mze04052]  Cytokines   Chemokines    101468246 Glycosaminoglycan binding proteins [BR:mze00536]  Heparan sulfate / Heparin   Chemokines    101468246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101468246 NCBI-ProteinID:  XP_004564325 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MISNRIIVSSIVVLLTLLATCEGMGVELHCRCIQTESKPIGRHIEKVELILPNSHCEETE IIATLKRTGEEVCLNPEAPWVKKVINKIMSSSRP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgataagcaacagaatcattgtcagctccatcgtggtgcttttgaccctgctggccacc tgtgaaggcatgggagtggaactgcactgccgttgcattcagacagaaagcaaacctatt ggccgccacatcgagaaggtggagttgattcttcccaactcccactgcgaggagacggag atcattgccacactgaaaaggacaggtgaagaggtttgccttaatcctgaggccccctgg gtcaagaaagtgatcaacaagatcatgtccagcagcagaccctga

DBGET integrated database retrieval system