Maylandia zebra (zebra mbuna): 101474323 Help Entry 101474323         CDS       T02814                                  Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04080   Neuroactive ligand-receptor interaction mze04081   Hormone signaling Brite KEGG Orthology (KO) [BR:mze00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101474323    04081 Hormone signaling     101474323  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mze04052]     101474323 Cytokines and neuropeptides [BR:mze04052]  Neuropeptides   GPCR binding    101474323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  101474323 NCBI-ProteinID:  XP_012776727 LinkDB All DBs Position LG16:27909952..27914093 Genome browser AA seq 88 aa AA seqDB search MFRNDGAKMRVCVMLFVVLLLNGTLSESQRDGSVIIRDPDISASWYTGRGIRPLGRFGRK AARRNELLAFITARVYRPTADSGVWITQ NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtttcgaaacgatggagctaaaatgagggtgtgtgtgatgctgtttgttgtcttgctg ttgaatggaactctgagtgaatctcagagagatggctctgtcattattagagatccagat atcagtgcctcctggtacacaggcagggggatcagaccccttgggagatttggtcgaaaa gctgcaagaagaaatgaacttctggctttcatcacagcgagagtttatagaccaacagct gacagtggcgtttggatcacacaatga

DBGET integrated database retrieval system