Maylandia zebra (zebra mbuna): 101477134 Help Entry 101477134         CDS       T02814                                  Name (RefSeq) protein S100-P   KO K17274   protein S100-A10 Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04382   Cornified envelope formation mze05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mze00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101477134  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101477134  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mze04147]     101477134 Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of microglial cells    101477134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 SPARC_Ca_bdg DEK_C Motif Other DBs NCBI-GeneID:  101477134 NCBI-ProteinID:  XP_004541320 UniProt:  A0A3P9CE84 LinkDB All DBs Position LG11:17028985..17030154 Genome browser AA seq 96 aa AA seqDB search MTDLEKSMDSMITVFNKYAHDGKHGKALTKKELRKLIEAELPNFLKTQKNANSVDHIMKD LDQNKDDVLDFEEFMPFIAGLTMACEKYCSMSAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgactgacttggagaaatccatggattccatgataaccgtgttcaacaagtatgcccat gatggcaaacacggaaaggccttaaccaagaaagaactaagaaaactaattgaggctgag cttcccaactttctgaaaacccagaagaatgccaactccgtggaccatatcatgaaggat ctggaccagaacaaagatgatgtcttggactttgaagaatttatgccattcatcgccggc ctcacaatggcctgtgaaaaatattgctccatgtctgctaaaaagaagtga

DBGET integrated database retrieval system