Maylandia zebra (zebra mbuna): 101478443 Help Entry 101478443         CDS       T02814                                  Symbol arf6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04144   Endocytosis mze04517   IgSF CAM signaling mze05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mze00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101478443 (arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101478443 (arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101478443 (arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mze04131]     101478443 (arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mze04147]     101478443 (arf6)    04031 GTP-binding proteins [BR:mze04031]     101478443 (arf6) Membrane trafficking [BR:mze04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101478443 (arf6)   Arf GTPases and associated proteins    Arf GTPases     101478443 (arf6) Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101478443 (arf6)   Exosomal proteins of colorectal cancer cells    101478443 (arf6) GTP-binding proteins [BR:mze04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101478443 (arf6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  101478443 NCBI-ProteinID:  XP_004542158 LinkDB All DBs Position LG15:complement(4385397..4388455) Genome browser AA seq 175 aa AA seqDB search MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaaatgctttcaaagatctttggcaacaaggagatgagaatattgatgcttgga cttgatgctgctgggaaaactaccatcctgtacaagctgaagctgggacagtcagtcacc accatccccactgttggtttcaatgtggagactgtcacctataagaatgtgaagttcaat gtgtgggacgtggggggacaagataagatcaggccgctctggagacattactacacgggc acccaggggctcatttttgtggtggactgtgccgacagggataggatcgacgaggcgagg caggagctccaccgcatcatcaacgaccgggagatgcgggacgccatcatcctcatcttc gccaacaagcaggacctcccagatgccatgaaaccacacgagatccaggagaagctgggc ctgacgcggatcagagataggaattggtacgttcagccttcgtgtgcgacgacaggggac ggactctacgagggcctgacctggcttacctcaaattataagtcttaa

DBGET integrated database retrieval system