Maylandia zebra (zebra mbuna): 101479115 Help Entry 101479115         CDS       T02814                                  Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism mze  Maylandia zebra (zebra mbuna) Brite KEGG Orthology (KO) [BR:mze00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mze03019]     101479115    03029 Mitochondrial biogenesis [BR:mze03029]     101479115 Messenger RNA biogenesis [BR:mze03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      101479115 Mitochondrial biogenesis [BR:mze03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     101479115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  101479115 NCBI-ProteinID:  XP_004569203 UniProt:  A0A3P9CFX8 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MDPCECAKTGTCNCGGSCTCTKCSCKSCKKSCCDCCPSGCSKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccctgcgagtgcgccaagactggaacctgcaactgcggaggatcctgcacgtgc acaaagtgctcatgcaagagctgtaagaagagctgctgcgactgctgcccatccggctgc agcaaatgcgcctctggctgcgtgtgcaaagggaagacgtgcgacaccagctgctgccag tga

DBGET integrated database retrieval system