Maylandia zebra (zebra mbuna): 101480389 Help Entry 101480389         CDS       T02814                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mze00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101480389  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mze04121]     101480389    03400 DNA repair and recombination proteins [BR:mze03400]     101480389 Ubiquitin system [BR:mze04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101480389    Cul5 complex      101480389 DNA repair and recombination proteins [BR:mze03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101480389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101480389 NCBI-ProteinID:  XP_004575029 UniProt:  A0A3P9CA15 LinkDB All DBs Position LG8:complement(10855398..10861083) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tccaccactgtctatgagctgaagcgtattgtcgagggaatacttaaaagaccacccgag gaccagcgactctacaaagatgatcagctgctagaggacagcaaaactctgggtgactct ggattcaccaaccagactgccagacctcaagccccagctacagtcggtctggcctttcgt attaatgatgagatgtttgagcagctgcacatcgaggccttttccagccccccggaactc cctgatgtgatgaagcctcaggactctggtagcactgctaatgaacaggcagtgcagtga

DBGET integrated database retrieval system