Maylandia zebra (zebra mbuna): 101481969 Help Entry 101481969         CDS       T02814                                  Symbol pfn2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04810   Regulation of actin cytoskeleton mze05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mze00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101481969 (pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101481969 (pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mze04131]     101481969 (pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mze04812]     101481969 (pfn2)    04147 Exosome [BR:mze04147]     101481969 (pfn2) Membrane trafficking [BR:mze04131]  Others   Actin-binding proteins    Others     101481969 (pfn2) Cytoskeleton proteins [BR:mze04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101481969 (pfn2) Exosome [BR:mze04147]  Exosomal proteins   Proteins found in most exosomes    101481969 (pfn2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101481969 NCBI-ProteinID:  XP_004562022 UniProt:  A0A3P9CP41 LinkDB All DBs Position LG15:30859178..30867085 Genome browser AA seq 139 aa AA seqDB search MSWQSYVDNLMADGSCQDAAIVGYADAKYVWASFVGGTFANITPEEIDVLVGKDREGFFT SGLTLGNKKCSVIRDSLQIDNDWTMDIRTKSQGGEPTYNVSVGRAAKALVIVMGKEGVHG GQLNKKAFQMSEYLRKSGY NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcctggcaaagctacgtggacaacctgatggccgatggcagctgccaggacgcggcc attgttgggtatgcggacgccaaatatgtctgggcatcttttgtcggcggtacctttgcc aacataacgcctgaagaaattgatgtgttagtaggaaaggaccgagagggattcttcacc agtgggctgaccctgggcaataaaaagtgctccgtaatcagagacagcctccaaattgac aacgactggacaatggacatccgaacaaagagtcaaggaggagagcccacatacaatgtt tctgtaggcagagcagccaaagcattggttattgtcatggggaaggaaggtgtccatgga gggcagctcaacaagaaagcatttcagatgtctgagtacctgaggaagtccggatactaa

DBGET integrated database retrieval system