Maylandia zebra (zebra mbuna): 101486009 Help Entry 101486009         CDS       T02814                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04068   FoxO signaling pathway mze04136   Autophagy - other mze04140   Autophagy - animal mze04621   NOD-like receptor signaling pathway mze04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:mze00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     101486009 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101486009 (atg12)    04136 Autophagy - other     101486009 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101486009 (atg12)    04622 RIG-I-like receptor signaling pathway     101486009 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mze04131]     101486009 (atg12)    04121 Ubiquitin system [BR:mze04121]     101486009 (atg12)    03029 Mitochondrial biogenesis [BR:mze03029]     101486009 (atg12) Membrane trafficking [BR:mze04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     101486009 (atg12) Ubiquitin system [BR:mze04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    101486009 (atg12) Mitochondrial biogenesis [BR:mze03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     101486009 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 XendoU Motif Other DBs NCBI-GeneID:  101486009 NCBI-ProteinID:  XP_004550782 UniProt:  A0A3P9CJG3 LinkDB All DBs Position LG11:complement(18484865..18489461) Genome browser AA seq 117 aa AA seqDB search MSDTAESPTETQKEETQPPSDDSTTNDEKKKIDVLLKAVGDTPIMKTKKWAVDRGRTVQS LSQFISRFLKLDANEQLFIYVNQSFAPSPDQEVGVLFDCFGSDGKLILHYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgacactgcagagtccccaacagagacgcagaaagaagaaacacagccgccgtca gacgactcgacgacaaatgacgagaagaagaaaatcgatgtgctgttgaaggcagtggga gacactcctataatgaaaacaaagaagtgggcagtggacagggggagaacagtacagtct ctttcacaattcatatctcgcttcctcaagcttgatgccaatgaacaactattcatctat gttaaccagtcttttgccccctcaccggatcaagaagtaggggtcctctttgattgtttt ggaagtgatggcaagctgattctacattattgtaaatctcaagcctggggttag

DBGET integrated database retrieval system