Maylandia zebra (zebra mbuna): 106674735 Help Entry 106674735         CDS       T02814                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism mze  Maylandia zebra (zebra mbuna) Pathway mze03272   Virion - Hepatitis viruses mze04382   Cornified envelope formation mze04514   Cell adhesion molecule (CAM) interaction mze04530   Tight junction Brite KEGG Orthology (KO) [BR:mze00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106674735  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     106674735  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106674735  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106674735  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mze03037]     106674735    04147 Exosome [BR:mze04147]     106674735 Cilium and associated proteins [BR:mze03037]  Other cilia and associated proteins   Stereociliary proteins    106674735 Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106674735   Exosomal proteins of colorectal cancer cells    106674735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC TMEM37 DUF2207_C Motif Other DBs NCBI-GeneID:  106674735 NCBI-ProteinID:  XP_024659808 LinkDB All DBs Position LG10:complement(17666362..17666949) Genome browser AA seq 140 aa AA seqDB search MWRVTAFIGTNIVTAQAIHEGLWMSCVVQSTSQKQCKVYDSKLALSQDLQAARALIIIAI LLGFFGILFAVVGYRCTHAMIKDFYNPLWSASQKRELGSSLYIGWGSAGLLFLGGGLLCS SRPRMNDTDCEVRYSNHRAV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtggagagtgacagccttcattggtaccaacatcgtcacagctcaagcaatccacgag ggcttgtggatgagctgtgtggtccagagtacgagccagaagcagtgtaaggtctatgat tcgaagttggccttatctcaagatttgcaggctgcccgagcgctcatcatcatcgccatc ctgttagggttctttgggatcctgtttgctgtagttgggtacaggtgcacccacgctatg attaaggatttctacaacccactctggtccgcttctcagaagagggagctgggatcatcg ctttacatcggctggggctctgcaggactgctgttcctgggaggaggcctcctctgcagc tcccgtcctcgtatgaatgacactgactgtgaggttaggtattccaaccatcgtgctgtt taa

DBGET integrated database retrieval system