Methanolobus zinderi: HWN40_02530 Help Entry HWN40_02530       CDS       T06665                                  Name (GenBank) histone family protein   KO K24450   DNA-binding protein Organism mzi  Methanolobus zinderi Brite KEGG Orthology (KO) [BR:mzi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mzi03036]     HWN40_02530 Chromosome and associated proteins [BR:mzi03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     HWN40_02530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Bromo_TP TFIID-31kDa CENP-S CENP-T_C TAF TFIID-18kDa Peptidase_C39 DUF1931 LonB_AAA-LID PCP_red Motif Other DBs NCBI-ProteinID:  QLC49219 UniProt:  A0A7D5E6T4 LinkDB All DBs Position complement(504204..504416) Genome browser AA seq 70 aa AA seqDB search MTIIPFAPIERVIRNAGAQRVSESAAIALTEMLESYGLEISREAIKLAEHAGRKTVKAED IKLAKEMLDK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacaataataccatttgcacccattgaaagggtaataagaaatgctggagctcagaga gtaagcgaatcagcggccatagccctgacagagatgcttgagtcatatggactcgagata tcaagagaagcaataaaactggcagagcatgccggaagaaaaaccgttaaagcagaagat atcaaactcgcaaaagagatgctggacaagtaa

DBGET integrated database retrieval system