Methanolobus zinderi: HWN40_03660 Help Entry HWN40_03660       CDS       T06665                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mzi  Methanolobus zinderi Pathway mzi03010   Ribosome Brite KEGG Orthology (KO) [BR:mzi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HWN40_03660   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HWN40_03660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mzi03011]     HWN40_03660    04121 Ubiquitin system [BR:mzi04121]     HWN40_03660   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mzi04147]     HWN40_03660 Ribosome [BR:mzi03011]  Ribosomal proteins   Eukaryotes    Small subunit     HWN40_03660   Archaea     HWN40_03660 Ubiquitin system [BR:mzi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HWN40_03660 Exosome [BR:mzi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HWN40_03660   Exosomal proteins of colorectal cancer cells    HWN40_03660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Lar_restr_allev DUF1451 Cas12f1-like_TNB Zn_ribbon_NUD DUF5795 DZR_2 Zn_ribbon_IS1595 Zn_ribbon_3 Zf_2nd_IFT121 MqsA_antitoxin Zn_ribbon_13 Zn-ribbon_GIR1 Zn_ribbon_Nudix Zn_Ribbon_TF DUF7575 Motif Other DBs NCBI-ProteinID:  QLC49422 UniProt:  A0A7D5I7Y9 LinkDB All DBs Position complement(725515..725664) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVSGDSIERTHQACPRCGEGVFLAEHKDRRSCGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaggattactacaaggtaagcggcgattctatcgaaaggacacaccaggca tgcccccgctgcggtgaaggcgtattccttgcagagcacaaggacaggcgttcctgcgga aaatgcggctacactgagtttaagaaataa

DBGET integrated database retrieval system