Mycetomoellerius zeteki: 108722788 Help Entry 108722788         CDS       T11078                                  Symbol Rab7 Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mzt  Mycetomoellerius zeteki Pathway mzt04137   Mitophagy - animal mzt04140   Autophagy - animal mzt04142   Lysosome biogenesis mzt04144   Endocytosis mzt04145   Phagosome mzt04148   Efferocytosis Brite KEGG Orthology (KO) [BR:mzt00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108722788 (Rab7)    04145 Phagosome     108722788 (Rab7)    04142 Lysosome biogenesis     108722788 (Rab7)    04140 Autophagy - animal     108722788 (Rab7)    04137 Mitophagy - animal     108722788 (Rab7)    04148 Efferocytosis     108722788 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mzt04131]     108722788 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mzt04147]     108722788 (Rab7)    04031 GTP-binding proteins [BR:mzt04031]     108722788 (Rab7) Membrane trafficking [BR:mzt04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108722788 (Rab7) Exosome [BR:mzt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108722788 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    108722788 (Rab7)   Exosomal proteins of colorectal cancer cells    108722788 (Rab7)   Exosomal proteins of bladder cancer cells    108722788 (Rab7) GTP-binding proteins [BR:mzt04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108722788 (Rab7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 AAA_16 Septin PduV-EutP AAA_7 AAA_22 NTPase_1 G-alpha AAA_24 AAA_5 AAA_14 NB-ARC ATPase_2 NACHT SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  108722788 NCBI-ProteinID:  XP_018303586 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLESRAVSSKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGRGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatctcgcaagaaagttttgctgaaagtaattatccttggggattcgggagttggg aaaacttctttaatgaaccaatatgtcaataagaagtttagcaaccaatataaagcgaca ataggggcagattttttgactaaggaagtgatggtagaggatagaatagtcactatgcag atttgggataccgctggacaggagaggtttcaatcgttaggagtggctttttatagaggc gcagactgttgtgtactggtatttgatgtatcggctccaactagcttcaaatctctagat tcatggagggatgaatttttaattcaagcctcgcctcgagatccagacaattttccgttt gtcgtgctcgggaacaaagtagatcttgaatcaagagcagtctcaagcaagagagcacaa cagtggtgtcaatcaaagaacaatattccatattttgaaactagtgcaaaagaggctatt aatgttgagcaagctttccaaacgatagctaagaatgctttagctcaagaaagtgaagtc gaactttacaatgaattcccggatcaaatcaaattgaccaacgaccaaagaagcaatggt agaggtgattcatgtgcttgctag

DBGET integrated database retrieval system