Nanohaloarchaea archaeon SG9: AQV86_01140 Help Entry AQV86_01140       CDS       T04498                                  Name (GenBank) histone   KO K24450   DNA-binding protein Organism nac  Nanohaloarchaea archaeon SG9 Brite KEGG Orthology (KO) [BR:nac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nac03036]     AQV86_01140 Chromosome and associated proteins [BR:nac03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AQV86_01140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF CENP-T_C Bromo_TP CENP-S Histone TFIID-31kDa TAF LonB_AAA-LID DUF1931 Motif Other DBs NCBI-ProteinID:  AOV94513 UniProt:  A0A1D8MR91 LinkDB All DBs Position complement(182647..182844) Genome browser AA seq 65 aa AA seqDB search MAELPLAPVKRIIKQAGAARVSEDAVEELRDELEAHAEDRAREAKQYAEHAGRKTVQADD VRTSQ NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggcagaactaccactcgcacccgtcaagagaatcatcaagcaggccggcgcagcaaga gtctctgaagatgctgtagaggagctcagagatgagctagaagctcacgcagaagacaga gcaagagaagctaagcagtacgcagaacacgctggtcgtaagacggttcaggcggacgac gtcagaacttcccagtaa

DBGET integrated database retrieval system