Nanohaloarchaea archaeon SG9: AQV86_01430 Help Entry AQV86_01430       CDS       T04498                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism nac  Nanohaloarchaea archaeon SG9 Pathway nac03060   Protein export nac04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nac00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AQV86_01430    04141 Protein processing in endoplasmic reticulum     AQV86_01430  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AQV86_01430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nac04131]     AQV86_01430   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:nac02044]     AQV86_01430 Membrane trafficking [BR:nac04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     AQV86_01430 Secretion system [BR:nac02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    AQV86_01430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE PKK Motif Other DBs NCBI-ProteinID:  AOV94570 UniProt:  A0A1D8MRD0 LinkDB All DBs Position complement(234801..235001) Genome browser AA seq 66 aa AA seqDB search MELDPNSIKNDVKSKLKEYQRVLKISDKPDREEFEMAAKVTGAGMAIIGIIGFLFYLVSS LLPKLV NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggaactcgatcctaactcaatcaagaatgatgtgaagagcaagttgaaggagtatcag cgagtgctcaagatttcggataaaccggatagagaggagttcgagatggctgccaaggtt actggagcaggtatggccatcatcggtattatcgggttcctgttttaccttgtgagttcg ctactacctaagctggtgtga

DBGET integrated database retrieval system