Nanohaloarchaea archaeon SG9: AQV86_05335 Help Entry AQV86_05335       CDS       T04498                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nac  Nanohaloarchaea archaeon SG9 Pathway nac03010   Ribosome Brite KEGG Orthology (KO) [BR:nac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AQV86_05335   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AQV86_05335  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nac03011]     AQV86_05335    04121 Ubiquitin system [BR:nac04121]     AQV86_05335   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nac04147]     AQV86_05335 Ribosome [BR:nac03011]  Ribosomal proteins   Eukaryotes    Small subunit     AQV86_05335   Archaea     AQV86_05335 Ubiquitin system [BR:nac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AQV86_05335 Exosome [BR:nac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AQV86_05335   Exosomal proteins of colorectal cancer cells    AQV86_05335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Prok-RING_1 Zn_ribbon_3 Ribosomal_L37e DZR zf-FPG_IleRS Zn_ribbon_RPB9 Cas12f1-like_TNB Zn_Ribbon_1 Zn_ribbon_PaaD RUBY_RBDX Med26_M Auto_anti-p27 Cript zf_UBZ Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  AOV95311 UniProt:  A0A1D8MTG8 LinkDB All DBs Position 979430..979579 Genome browser AA seq 49 aa AA seqDB search MGKHEVVQIHEKYDEEGNYTGEKCPRCGSFLAEHDNRKACGKCGYTKHE NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgggaaaacatgaagtagtccagatccacgaaaaatacgacgaagaaggcaactacaca ggagagaaatgcccaagatgcggatccttcctggccgaacacgacaaccgcaaagcatgc ggcaaatgcggctacacaaaacacgaataa

DBGET integrated database retrieval system