Candidatus Nucleicultrix amoebiphila: GQ61_06305 Help Entry GQ61_06305        CDS       T04833                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism naf  Candidatus Nucleicultrix amoebiphila Pathway naf03430   Mismatch repair Brite KEGG Orthology (KO) [BR:naf00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     GQ61_06305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:naf03400]     GQ61_06305 Enzymes [BR:naf01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      GQ61_06305 DNA repair and recombination proteins [BR:naf03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      GQ61_06305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF7260 DUF6776 Motif Other DBs NCBI-ProteinID:  ARN84960 UniProt:  A0A1W6N510 LinkDB All DBs Position 1242282..1242533 Genome browser AA seq 83 aa AA seqDB search MTDQPSTKEITLSFEAALKELEEIVRKMESGQVPLEEAIAFYERGTELRERCEGLLKSAQ LKIEEVTLDAQKHPKVTLSDLEP NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacagatcaaccatcaacaaaagaaataacactttctttcgaagccgctctcaaagag ttggaagagattgtacgcaagatggaaagtgggcaagttcctctagaagaagcaattgct ttttatgaaagaggtacagaacttcgtgagcgttgtgaggggcttttaaagagcgcacag cttaaaattgaagaagttaccctggatgcacaaaagcaccctaaagttacgctatctgat cttgagccatag

DBGET integrated database retrieval system