KEGG   Natrarchaeobaculum sulfurireducens AArc-Mg: AArcMg_1033
Entry
AArcMg_1033       CDS       T05593                                 
Name
(GenBank) NADH-ubiquinone oxidoreductase chain J2
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
nag  Natrarchaeobaculum sulfurireducens AArc-Mg
Pathway
nag00190  Oxidative phosphorylation
nag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nag00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AArcMg_1033
Enzymes [BR:nag01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     AArcMg_1033
SSDB
Motif
Pfam: Oxidored_q3 DUF6479
Other DBs
NCBI-ProteinID: AXR81050
UniProt: A0A346PHA9
LinkDB
Position
complement(1022575..1023018)
AA seq 147 aa
MTNRPRLHTSGTLAPGLLAVVLFGVMAAIAWTTQFGEMSGYPDGIAITSEIGYAMFNLEA
LQSGEGAIPDTEPFLVAFILIAIVLDAALDASLVLAKREEGGEPVSPLASQRDTRPASGG
AVADGGHEPTSRVGPTDGARTEGGESR
NT seq 444 nt   +upstreamnt  +downstreamnt
atgacgaaccgaccgagactccacacgagtggaaccctcgcacccggattgctcgcagtc
gtcctcttcggcgtgatggcggcgatcgcgtggacgacccagttcggggagatgagcggc
tatccggacggaatcgccatcacctccgagatcggatacgcgatgttcaacttggaggcg
ctgcagtccggtgagggggcgatccccgacaccgagccgttcctcgtcgcgttcatcctg
atcgcgatcgtcttagacgccgcactcgacgcgtcgttggtcctcgcaaagcgcgaggaa
ggcggcgagccagtctcgccgctggctagccagcgcgatacccgaccggcgtccggcggc
gcagttgccgacggtggtcacgaacccacctcgagggtcggccccaccgacggggctcga
acggaggggggtgagtctcgatga

DBGET integrated database retrieval system