Nocardia arthritidis: F5544_09095
Help
Entry
F5544_09095 CDS
T06735
Name
(GenBank) hypothetical protein
KO
K04565
superoxide dismutase, Cu-Zn family [EC:
1.15.1.1
]
Organism
nah
Nocardia arthritidis
Pathway
nah04146
Peroxisome
Brite
KEGG Orthology (KO) [BR:
nah00001
]
09140 Cellular Processes
09141 Transport and catabolism
04146 Peroxisome
F5544_09095
Enzymes [BR:
nah01000
]
1. Oxidoreductases
1.15 Acting on superoxide as acceptor
1.15.1 Acting on superoxide as acceptor (only sub-subclass identified to date)
1.15.1.1 superoxide dismutase
F5544_09095
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
QIS09720
UniProt:
A0A6G9Y9C4
LinkDB
All DBs
Position
2061576..2061950
Genome browser
AA seq
124 aa
AA seq
DB search
MRMLLGAFVLSAGAALVFMPTASARPDASEANVAVLKVNHANGDVTAAYECSGIENPQIE
ITLTREADGKTGNGETSDLNCDGKPHFTTFATTLGAGKHGDKYDAEIRLGEIDVRIQGSE
DVPI
NT seq
375 nt
NT seq
+upstream
nt +downstream
nt
atgaggatgctgctcggcgcattcgtgctttccgccggtgccgcgctcgtgttcatgccg
accgccagcgccaggcccgacgcgagcgaagccaatgtcgcagtactgaaggtcaatcac
gccaacggcgacgtcaccgctgcgtacgagtgcagcggcatagaaaacccacagatcgaa
attacgttgacgcgcgaggcggatggcaagaccggcaatggcgaaaccagcgacctgaac
tgcgacgggaaaccgcatttcaccaccttcgcgaccaccttgggggcgggaaaacacggc
gacaagtacgacgccgagatccgtctcggcgaaatcgacgtaaggattcaaggctcggag
gacgtgccgatttag
DBGET
integrated database retrieval system