Nocardia arthritidis: F5544_10725 Help Entry F5544_10725       CDS       T06735                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism nah  Nocardia arthritidis Pathway nah00253   Tetracycline biosynthesis nah01056   Biosynthesis of type II polyketide backbone nah01100   Metabolic pathways nah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nah00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     F5544_10725    00253 Tetracycline biosynthesis     F5544_10725  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:nah01004]     F5544_10725    01008 Polyketide biosynthesis proteins [BR:nah01008]     F5544_10725 Lipid biosynthesis proteins [BR:nah01004]  Polyketide synthase   Component type    F5544_10725 Polyketide biosynthesis proteins [BR:nah01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      F5544_10725     Nonaketide PKS      F5544_10725     Decaketide PKS      F5544_10725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIS10041 UniProt:  A0A6G9YA00 LinkDB All DBs Position complement(2469417..2469680) Genome browser AA seq 87 aa AA seqDB search MRTFTLDDLRRIIRQCAGEDDSTGLDADDILDVDFVDLGYDSLALLETNNCVSREFGVSL PEEELTEVQTPGAFITLVNQHLARQRV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcggacattcacattggacgacctcaggcgcatcatccggcagtgcgcgggcgaggac gattcgaccgggctcgatgccgacgacatcctcgatgtcgatttcgtagacctcggctac gactcactcgcgttgttggaaacgaacaactgcgtatcccgcgaattcggggtatcgctg ccggaggaggaactcaccgaagtacagaccccgggggccttcatcaccctggtgaaccag cacctggcgcggcagcgggtctga

DBGET integrated database retrieval system