Nocardia arthritidis: F5544_25405 Help Entry F5544_25405       CDS       T06735                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism nah  Nocardia arthritidis Pathway nah00998   Biosynthesis of various antibiotics nah01100   Metabolic pathways nah01110   Biosynthesis of secondary metabolites Module nah_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:nah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F5544_25405    00074 Mycolic acid biosynthesis     F5544_25405   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F5544_25405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QIS12935 UniProt:  A0A6G9YI07 LinkDB All DBs Position complement(5692560..5692811) Genome browser AA seq 83 aa AA seqDB search MSTERVIEDLLTLFADVVGDPAVHGIDTVRGDMDVWDSLAQVRLVYAVERHFGVELPGNL LTSEVSLAEVAAAISAAREADVS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaacgcgtgatcgaggatctgctcaccctgttcgccgatgtggtcggcgat ccggccgtacacggaatcgacaccgtgcgcggcgatatggacgtctgggattcgctggcc caggtgcggctggtgtacgcggtggagcgacatttcggcgtcgagttgccagggaacctg ctcacctccgaggtatcgctcgccgaggtggccgccgccatatccgccgcgcgggaggcg gatgtgtcatga

DBGET integrated database retrieval system