Nocardia arthritidis: F5544_42880
Help
Entry
F5544_42880 CDS
T06735
Name
(GenBank) hypothetical protein
Organism
nah
Nocardia arthritidis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
QIS16384
UniProt:
A0A6G9YT55
LinkDB
All DBs
Position
complement(9487467..9490241)
Genome browser
AA seq
924 aa
AA seq
DB search
MVAESALITGGSQLSAIIAAGGQSVAAAETNAAANLGAAVQTGATADVGTGLDVNGGFGT
GLQTGVDVGALANAGADLAAGINGALGAGAQALTGLETGLSTGIGLSTSLLGAADTGTQV
GADVAAGLQGAANAGADLATGLQAAAGLGAGLTGAIDSAASAATGLNALVSNGFGGDVAA
ALHGVTDAGAALTGITDAAANLGTALNATTQLTTGLEAATTAATDLSTDLQAGANTGADL
STALTGTLGTQAATNVETGLSTGTQIGSDLSTVLQGAVNSSAAVDSNLSTGLTGAVDAAA
QTGAGLETGLSTGLGTATDVGTQVGSDLSADLQGAVNSSAAVGNSLSGGLTATADSVTQV
GAGLSTGLDAAVNAGSDLAAGAQGVANSGAAVDSSLSAGLTGAVDAAAQAGAGLETGLST
GLGIATDVGTQVGSDLSAGLQGAVNSSAAVGDSVSSGLMAAADSVTQVGAGLSTGLTGVV
GTAAQAGAGLETGLSTGLGTAADVGTQVGTDLSADLQGAVNSSAAVGDSVSSGLTGAADS
AGQVGAGLSTGLGAAVNAGSDLAAGVQGVANSGAAVGSSLSTGLTGAVGTAAQVGAGLST
GIDAGAGAQVGSALTGGLHGTADSVGNIGSAVSGGLTAAAGTGAQVGTGLSTGLGVGTGL
ASGLSGGLGGAVDASAQVGSGLGTGLSDGVHAASDLTAGLTGAVGTGAQVGTGLGTGLSG
GVGGAVDAGAQIGSGLRTGLSGGAHAASDLTAGLTGAVDSGAHVGTGLTGGVGGAVDAGA
QVGSGLGTGLSGGAHAASDLTAGLTGAVDSGAHVGTGLASGVGGAVDAGAHVGTGLETGI
SSGLAGAVNAGGQVGAGVGGAVDTGAHVGSGLGQVFPQAWVVLWMVAHMPYRISVAGWGA
PRSEVVRAQGFPQGSTVVCTAGPR
NT seq
2775 nt
NT seq
+upstream
nt +downstream
nt
atggtcgccgagtcggcgctgatcaccggcggctctcagctctcggccatcatcgcggcg
ggcggccagtccgtcgccgcggcggagacgaatgccgcggcgaacctgggggccgccgta
caaacgggcgcgaccgccgacgtcggcaccggcctcgatgtgaatggtggtttcggcacc
ggcctgcagacgggagtcgatgtcggcgccctcgccaacgcgggagccgacctggcggcg
ggaatcaacggcgcgctcggcgcaggcgcgcaggcactgaccggtctggaaaccggcctg
tccaccggcattggcctgtccacaagcctgctcggcgccgccgacaccggtacacaggtg
ggcgccgacgtcgccgccggactccaaggcgcggccaacgcgggagccgatctcgccacc
ggactgcaggccgccgccggtctcggcgcgggcctcaccggtgccatcgacagtgccgca
tcggcggcgaccggtctgaatgctttggtatccaacggattcggcggcgatgtagccgct
gccctgcatggcgtcaccgacgcgggcgccgccctcaccggcataaccgacgccgccgca
aacctcggcaccgccctgaacgcgaccacccaactgaccaccggcctcgaagccgcgaca
accgccgccaccgacctctccaccgacctgcaagccggcgccaacaccggagcagacctg
tcgaccgccctgaccggcaccctcggcacccaggcagccaccaatgtggaaaccggcctc
tccaccggaacccaaatcggttccgacctttccaccgttctgcaaggcgcagtgaattcc
agtgcggccgttgacagtaacttgtccacaggtttgaccggtgcggttgatgccgcagca
cagacgggtgccggtctggagactggcctgtcgaccggactcggcaccgccaccgatgtt
ggtacgcaggttggctcggatctgtcggctgatctccagggcgcggtgaattccagtgcg
gccgttggcaacagcctctccggcgggctgacagctacggcggattccgtcacgcaggtc
ggtgctggtctgtccactggtctcgatgcggcggtgaacgctggatccgatcttgcggcc
ggtgcgcagggcgtcgcgaattccggtgcggccgttgacagtagcttgtccgcgggtttg
acgggtgcggttgatgccgcggcgcaggcgggtgccgggctggagactgggctgtcgacc
ggactcggcatcgcaaccgatgtcggtacgcaggttggctcggatctgtctgccggtctg
cagggcgcggtgaattccagcgcagccgtgggcgatagcgtttccagtggattgatggct
gcggcggattcggtcacgcaggtcggggctggcttgtccacgggtttgacgggtgtggtc
ggtactgcggcgcaggcgggtgccggtctggagactggtctgtcgaccggactcggtacc
gccgccgatgttggtacgcaggttggcacggatctgtctgctgatctgcagggcgcagtg
aattccagtgcggccgtgggcgacagcgtttccagtggactgacgggtgcggcggattcc
gctggacaggtcggggccggactgtccactggtctcggtgcggcggtgaatgccggatcc
gaccttgcggccggtgtgcagggtgttgcgaattctggtgcggctgtgggtagtagcttg
tccaccggtttgacgggtgcggtcggtactgcggcgcaggtgggtgccggtctgtccaca
ggcatcgatgccggagctggtgcacaggtggggtccgctcttacggggggcttgcacggt
acggctgattcggttggaaacattggctcggcggtttcgggcggcctgacggcggctgcc
ggtaccggggcgcaggtggggaccgggttgtcgactgggctcggggttggaacggggttg
gcgtccgggctttccggtggcctgggtggcgctgtggatgccagtgcacaggttgggagt
ggtttggggacggggctgtcggatggagttcatgccgcgtcggatttgactgctgggctt
acaggtgcggttggcactggcgcacaggtgggtacgggcttggggaccgggctttccggt
ggtgtgggtggcgctgtggatgccggtgcacagatcgggagtggtttgaggacggggctg
tccggtggggcgcacgccgcgtcggatttgactgcgggacttaccggtgcggttgacagt
ggtgcacacgtcgggaccgggctgaccggtggcgtgggtggcgctgtggatgccggtgca
caggttgggagtggtttggggacggggctgtccggtggggcgcatgccgcgtcggatttg
actgcgggacttaccggcgcggttgacagtggtgcacacgtcgggaccgggctggccagt
ggggtgggtggcgctgtggatgccggtgcgcatgtcgggaccggattggagacgggtatt
tcgagtgggttggcaggcgcggtgaatgccggagggcaggtcggtgccggcgtcggcggg
gcggtggataccggtgcgcatgttggaagtggtttggggcaggtatttccacaggcgtgg
gtggtgctgtggatggtggcgcacatgccgtatcggatctcggtggcggggtggggagcg
ccgcgctcggaagtggttcgagcacaggggtttccacagggatcgacagtggtttgcaca
gcggggccgcggtga
DBGET
integrated database retrieval system