Necator americanus (New World hookworm): NECAME_00612 Help Entry NECAME_00612      CDS       T04867                                  Name (RefSeq) Ras family protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nai  Necator americanus (New World hookworm) Pathway nai04145   Phagosome nai04148   Efferocytosis nai04310   Wnt signaling pathway nai04361   Axon regeneration nai04517   IgSF CAM signaling nai04518   Integrin signaling nai04519   Cadherin signaling nai04620   Toll-like receptor signaling pathway nai05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nai00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     NECAME_00612   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     NECAME_00612    04518 Integrin signaling     NECAME_00612    04519 Cadherin signaling     NECAME_00612  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     NECAME_00612    04148 Efferocytosis     NECAME_00612  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     NECAME_00612   09158 Development and regeneration    04361 Axon regeneration     NECAME_00612  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     NECAME_00612  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nai04131]     NECAME_00612   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nai04147]     NECAME_00612    04031 GTP-binding proteins [BR:nai04031]     NECAME_00612 Membrane trafficking [BR:nai04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     NECAME_00612  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     NECAME_00612   Macropinocytosis    Ras GTPases     NECAME_00612  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     NECAME_00612 Exosome [BR:nai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NECAME_00612   Exosomal proteins of other body fluids (saliva and urine)    NECAME_00612   Exosomal proteins of colorectal cancer cells    NECAME_00612   Exosomal proteins of bladder cancer cells    NECAME_00612 GTP-binding proteins [BR:nai04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     NECAME_00612 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  25340656 NCBI-ProteinID:  XP_013297428 UniProt:  W2T1T8 A0ABR1ECL7 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MSSPSRQIKCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMTLDNHTVNLGLW DTAGQEDYDRLRPLSYPQTDVFVLCFSIVSPVSFDNVATKWIPEIRQHCPDAPILLVGTK LDLRDEANPRSTGTEDRPPITKSQGQKCAQKIKAVKYLECSALTQQGLKQVFEDAVRAVI NPKPLKQKKSCTLL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgtcaagcccttcgaggcagattaagtgtgtcgtggtcggcgatggaactgttggaaag acttgtatgttgatttcatatactaccgactcatttcctgttcaatatgtgcctacagtt tttgacaattactctgctcagatgacattggacaatcatactgttaatctagggttatgg gatactgctggacaggaagactacgatcggctgagacctttaagttacccacaaacagac gtgttcgttctgtgcttcagcattgtctcaccagtctccttcgataatgtggctaccaaa tggatcccagaaattcgtcaacattgtccagatgcgcctattttgctcgttggtaccaaa ctggatctacgagatgaggcgaatccacgctctactggcactgaggataggccaccgatt acaaaaagtcaaggacagaaatgtgcgcagaaaatcaaagcagtgaaatatttggaatgt tcggctctcacacaacaaggcttgaaacaggtgttcgaggatgcagtaagagctgttatc aatccaaaaccgctaaaacagaagaagtcatgcacgttactttaa

DBGET integrated database retrieval system