Necator americanus (New World hookworm): NECAME_03820 Help Entry NECAME_03820      CDS       T04867                                  Name (RefSeq) ubiquitin family protein   KO K12160   small ubiquitin-related modifier Organism nai  Necator americanus (New World hookworm) Pathway nai03013   Nucleocytoplasmic transport Brite KEGG Orthology (KO) [BR:nai00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     NECAME_03820  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nai04121]     NECAME_03820    03029 Mitochondrial biogenesis [BR:nai03029]     NECAME_03820   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nai04812]     NECAME_03820 Ubiquitin system [BR:nai04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    NECAME_03820 Mitochondrial biogenesis [BR:nai03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     NECAME_03820 Cytoskeleton proteins [BR:nai04812]  Eukaryotic cytoskeleton proteins   Septins    Septin associated proteins     NECAME_03820 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rad60-SLD ubiquitin DUF4469 Motif Other DBs NCBI-GeneID:  25343854 NCBI-ProteinID:  XP_013297324 UniProt:  W2T289 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MADNGSEAPAAGDAGVEYIKLKVVGQDSNEVHFRVKNGTAMGKLKKSYADRTGVAVSSLR FLFDGRRINDDDTPKTLEMEEDDVIEVYQEQLGGCL NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcagacaatggcagtgaagcaccagctgctggagatgctggcgttgagtacatcaaa cttaaagttgtgggacaagattccaatgaagtgcacttccgtgtgaaaaacggaactgcg atgggcaaattgaagaaatcgtacgcagatcgtactggtgttgctgtttcctcattgcgt tttctcttcgatggacgccgaatcaatgatgacgacactccgaagaccttggaaatggag gaggatgatgtgattgaggtctaccaagaacagctcggtggatgcctttga

DBGET integrated database retrieval system