Necator americanus (New World hookworm): NECAME_03997 Help Entry NECAME_03997      CDS       T04867                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism nai  Necator americanus (New World hookworm) Brite KEGG Orthology (KO) [BR:nai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nai03036]     NECAME_03997   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nai04147]     NECAME_03997 Chromosome and associated proteins [BR:nai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     NECAME_03997 Exosome [BR:nai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NECAME_03997 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  25344029 NCBI-ProteinID:  XP_013296738 UniProt:  W2SZS6 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MLLSPSHIPPEKSAPCPKESRERCSRCGRLRPKKKNKKSGEKKRAADEEVASTRYVHEIL AAEHASTGTGSKLQG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgctgctgtcccccagtcatattcctcctgaaaaatcggcgccttgtccaaaagaatca agagaacgctgttctcgatgtggtcgattgcgcccaaagaagaaaaacaaaaaatctggt gaaaagaagcgtgccgctgatgaggaagtagcttcaactagatatgtccatgaaattctg gccgctgagcacgcttcaacagggactggctcgaagctacaagggtag

DBGET integrated database retrieval system