Necator americanus (New World hookworm): NECAME_09061 Help Entry NECAME_09061      CDS       T04867                                  Name (RefSeq) dynein light chain type 1   KO K10418   dynein light chain LC8-type Organism nai  Necator americanus (New World hookworm) Pathway nai04814   Motor proteins Brite KEGG Orthology (KO) [BR:nai00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     NECAME_09061  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nai03037]     NECAME_09061    04812 Cytoskeleton proteins [BR:nai04812]     NECAME_09061 Cilium and associated proteins [BR:nai03037]  Motile cilia and associated proteins   Dynein arm    NECAME_09061 Cytoskeleton proteins [BR:nai04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      NECAME_09061 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light ARS2 Motif Other DBs NCBI-GeneID:  25349090 NCBI-ProteinID:  XP_013302865 UniProt:  W2TFL5 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MNFGSRRKISARRRESRRWKEPPQKALRPENIQLRESSMNEEKTKDAIFFLGRAIEERGI ENEIATFLKRKFDEKHGGSWQCIVGRNFGMHLDCVEFVHMYISKISILLFRC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgaatttcggttcgcgtcggaagataagcgcccgaagacgagaatctcgtcgatggaaa gagcctccgcaaaaggcgctacgtccggaaaatatccaacttcgagagagcagtatgaat gaggaaaaaactaaagatgccatcttctttcttggtcgcgctatagaagaacgtggtata gaaaatgaaattgcgacatttttaaagcggaaatttgacgagaaacatggtggcagctgg cagtgcatcgttggacgtaacttcggaatgcatctggactgtgttgaattcgtccacatg tacataagcaagatctcaatcctcttatttcgctgctga

DBGET integrated database retrieval system