Necator americanus (New World hookworm): NECAME_10159 Help Entry NECAME_10159      CDS       T04867                                  Name (RefSeq) EF hand   KO K12751   myosin light chain 6 Organism nai  Necator americanus (New World hookworm) Pathway nai04814   Motor proteins Brite KEGG Orthology (KO) [BR:nai00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     NECAME_10159  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:nai04812]     NECAME_10159    04147 Exosome [BR:nai04147]     NECAME_10159 Cytoskeleton proteins [BR:nai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      NECAME_10159 Exosome [BR:nai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    NECAME_10159   Exosomal proteins of bladder cancer cells    NECAME_10159 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 AIF-1 Motif Other DBs NCBI-GeneID:  25350188 NCBI-ProteinID:  XP_013300998 UniProt:  W2TC81 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MDEQLADCREVFCYFDSRGDEKISVQQEFVEGLSHFDKEGNGLINVAELRHLLTTLGERL SDEEVDQLLAGHNDSHGNVNIADFVRNVMNS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggatgagcaacttgctgattgtcgagaagtattttgctatttcgacagcagaggagat gagaaaataagtgttcagcaggaatttgttgaagggctttctcatttcgataaagaagga aatggactgatcaatgttgcagagctgcgtcatctgctaactactctaggggagcgcttg tctgatgaagaagttgatcagcttctagctggacacaacgattcacatggcaatgttaac attgcagattttgtacgcaatgtcatgaattcctga

DBGET integrated database retrieval system