Necator americanus (New World hookworm): NECAME_10884 Help Entry NECAME_10884      CDS       T04867                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism nai  Necator americanus (New World hookworm) Brite KEGG Orthology (KO) [BR:nai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nai03036]     NECAME_10884   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nai04147]     NECAME_10884 Chromosome and associated proteins [BR:nai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     NECAME_10884 Exosome [BR:nai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NECAME_10884 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID Motif Other DBs NCBI-GeneID:  25350913 NCBI-ProteinID:  XP_013299863 UniProt:  W2T8V8 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKY TSSK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaattccttcgtgaacgacgttttcgagcgtattgctgctgaagcgtcacggcttgcc cattacaacaagcgttcgacgatctcttctcgtgaaatccaaactgctgtgcgcctgatt cttcccggagagctcgctaagcatgctgtgtccgaggggacaaaggctgtcaccaagtac acctctagcaagtag

DBGET integrated database retrieval system