Necator americanus (New World hookworm): NECAME_11368 Help Entry NECAME_11368      CDS       T04867                                  Name (RefSeq) Zn-finger in Ran binding protein   KO K11468   YY1-associated factor 2 Organism nai  Necator americanus (New World hookworm) Pathway nai03083   Polycomb repressive complex Brite KEGG Orthology (KO) [BR:nai00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     NECAME_11368  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nai03036]     NECAME_11368 Chromosome and associated proteins [BR:nai03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      NECAME_11368     Noncanonical PRC1 (PRC1.3/1.5)      NECAME_11368     Noncanonical PRC1 (PRC1.6)      NECAME_11368 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RanBP Ephrin_rec_like zf-Sec23_Sec24 Vps36-NZF-N C1_2 Motif Other DBs NCBI-GeneID:  25351397 NCBI-ProteinID:  XP_013299075 UniProt:  W2T4P6 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MEAVIPFFIKLLLSVFIFSMLLHPYSVVMSSTTSKKRVRKEDVAGFDECDAGSWECTVCT YRNRFEAFKCEMCDTRKGTSTRKPR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggaagctgttatcccttttttcattaaactgttactgtcagtcttcatctttagcatg ctgctgcacccttactcggtggttatgtccagtaccaccagcaaaaagcgcgtacggaaa gaggatgttgctggtttcgatgagtgcgacgctggtagttgggagtgtactgtttgtaca tatcgtaaccgtttcgaagctttcaaatgtgagatgtgcgacacaaggaaagggacatcc acgagaaaaccgcgg

DBGET integrated database retrieval system