Necator americanus (New World hookworm): NECAME_19065 Help Entry NECAME_19065      CDS       T04867                                  Name (RefSeq) glutaredoxin   KO K03676   glutaredoxin 3 Organism nai  Necator americanus (New World hookworm) Brite KEGG Orthology (KO) [BR:nai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:nai03110]     NECAME_19065 Chaperones and folding catalysts [BR:nai03110]  Protein folding catalysts   Protein disulfide isomerase    NECAME_19065 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 Thioredoxin_2 RNA_capsid Motif Other DBs NCBI-GeneID:  25359088 NCBI-ProteinID:  XP_013294224 UniProt:  W2STG8 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MYTKDYCPYCVRAKNELQQDGIEYVEKSLSDGGQSDESTAKGLIELTQCKTVPQIFICGK Y NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgtacacgaaagattattgtccttactgtgttcgagcgaaaaatgagctgcaacaggat ggaatagagtacgttgaaaagagtctaagcgacggtgggcagagtgacgagtctactgcg aaaggattaatagaattaactcaatgcaagaccgtgcctcagattttcatatgtggaaag tat

DBGET integrated database retrieval system