Natrarchaeobaculum aegyptiacum: B1756_10250 Help Entry B1756_10250       CDS       T04999                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism naj  Natrarchaeobaculum aegyptiacum Pathway naj03010   Ribosome Brite KEGG Orthology (KO) [BR:naj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     B1756_10250   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     B1756_10250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:naj03011]     B1756_10250    04121 Ubiquitin system [BR:naj04121]     B1756_10250   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:naj04147]     B1756_10250 Ribosome [BR:naj03011]  Ribosomal proteins   Eukaryotes    Small subunit     B1756_10250   Archaea     B1756_10250 Ubiquitin system [BR:naj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    B1756_10250 Exosome [BR:naj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    B1756_10250   Exosomal proteins of colorectal cancer cells    B1756_10250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_Nudix Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  ARS90071 UniProt:  A0A2Z2HS97 LinkDB All DBs Position complement(2084626..2084760) Genome browser AA seq 44 aa AA seqDB search MAHYELYNDDGSTDREQCPRCADAFLADHGDRSHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacactacgaactctacaacgacgacggcagcaccgaccgcgaacagtgcccccgc tgtgccgacgcgttcctcgccgaccacggcgaccgctctcactgcgggaagtgtggctac accgagtgggagtag

DBGET integrated database retrieval system