Nocardiopsis akebiae: KGD83_16355 Help Entry KGD83_16355       CDS       T08903                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism nake  Nocardiopsis akebiae Pathway nake00998   Biosynthesis of various antibiotics nake01100   Metabolic pathways nake01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nake00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KGD83_16355    00074 Mycolic acid biosynthesis     KGD83_16355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KGD83_16355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QUX26933 LinkDB All DBs Position complement(3775824..3776072) Genome browser AA seq 82 aa AA seqDB search MSDVKDRLKKVMVASLELKRDPASLPEKDIVDTLGLDSINTLEFLIWVENEFDIEIADED LSVRLVDDLDVLSAYVSERLSG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt ttgagcgacgtcaaggatcggctgaagaaggtcatggtcgcctccctcgaactcaaacgg gatccggccagcctccccgagaaggacatcgtggacacgctgggcctggactcgatcaac accctggagttcctgatctgggtggagaacgagttcgacatcgagatcgccgacgaggac ctctcggtgcgcctcgtcgacgacctcgacgtcctcagcgcctacgtcagcgagcggctc tccggctga

DBGET integrated database retrieval system