Neisseria animaloris: NCTC12227_00874 Help Entry NCTC12227_00874   CDS       T06907                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nani  Neisseria animaloris Pathway nani01100   Metabolic pathways nani01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nani00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC12227_00874 (acpP_2)    00074 Mycolic acid biosynthesis     NCTC12227_00874 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC12227_00874 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VEJ21148 UniProt:  A0A1X3CM58 LinkDB All DBs Position 1:943836..944096 Genome browser AA seq 86 aa AA seqDB search MSLETQIKQLIIDSLGLEDITAADIETDAPLFGDDGLGLDSVDALELGLAVQKTFGFQMD GEQQNLREHFASVQTLADFVRNRQQA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaaacacaaatcaaacaactgattatcgacagcttgggtttggaagacatc actgcggcagatattgaaaccgatgccccgcttttcggtgatgacggtttgggattggat tcggttgacgccttggaattgggtttggcggtacaaaaaaccttcggttttcaaatggac ggcgaacagcaaaacctgcgcgaacatttcgccagcgtgcaaacattggctgactttgtc cgcaaccggcaacaggcttaa

DBGET integrated database retrieval system