Neisseria animaloris: NCTC12227_01556 Help Entry NCTC12227_01556   CDS       T06907                                  Symbol rmlC Name (GenBank) dTDP-D-glucose 4,6-dehydratase   KO K01790   dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13] Organism nani  Neisseria animaloris Pathway nani00521   Streptomycin biosynthesis nani00523   Polyketide sugar unit biosynthesis nani00541   Biosynthesis of various nucleotide sugars nani01100   Metabolic pathways nani01110   Biosynthesis of secondary metabolites nani01250   Biosynthesis of nucleotide sugars Module nani_M00793   dTDP-L-rhamnose biosynthesis, glucose-1P => dTDP-L-Rha Brite KEGG Orthology (KO) [BR:nani00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00541 Biosynthesis of various nucleotide sugars     NCTC12227_01556 (rmlC)   09109 Metabolism of terpenoids and polyketides    00523 Polyketide sugar unit biosynthesis     NCTC12227_01556 (rmlC)   09110 Biosynthesis of other secondary metabolites    00521 Streptomycin biosynthesis     NCTC12227_01556 (rmlC) Enzymes [BR:nani01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.3  Acting on carbohydrates and derivatives     5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase      NCTC12227_01556 (rmlC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dTDP_sugar_isom Motif Other DBs NCBI-ProteinID:  VEJ21796 UniProt:  A0A3S4XTU6 LinkDB All DBs Position 1:1661055..1661357 Genome browser AA seq 100 aa AA seqDB search MLTRPPENLIRPHRYGHHSTFIPNIKILEPHVFGDERGFYVLGDGAEFVYKCTDYYNPQA EHCLLWNDPSVKIHWPLTGEPQLSAKDAAGKTLAQAVVFE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgctgacaaggccgcctgaaaacctaattcgaccgcatcgctatggacatcattccacc ttcattcccaacattaaaatcctcgagccgcacgtgttcggcgacgaacgcggcttttat gtactgggagacggcgcggaattcgtgtataaatgcaccgattactacaacccgcaagcc gagcattgcctgctgtggaacgacccttctgtgaagatccactggccgctcactggcgaa ccgcaactgtcggcgaaagatgcggccggcaaaacgcttgcccaagccgttgtttttgaa taa

DBGET integrated database retrieval system