Nitrospirillum viridazoti: Y958_09150
Help
Entry
Y958_09150 CDS
T04935
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
nao
Nitrospirillum viridazoti
Pathway
nao03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
nao00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Y958_09150
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
nao03011
]
Y958_09150
Ribosome [BR:
nao03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Y958_09150
Bacteria
Y958_09150
Archaea
Y958_09150
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
ASG20970
UniProt:
A0A248JR26
LinkDB
All DBs
Position
1:complement(1997535..1997897)
Genome browser
AA seq
120 aa
AA seq
DB search
MSNAKVLSARRKQRVRTRVRKLGQGRPRLSVFRSSQHIYAQVIDDVAGQTKAAASSIDKT
LRAELKTGADIEAAKAVGKLIAERAKEAGITEVVFDRGSYLFHGRVKALADAAREAGLQF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgagcaatgcaaaagttctgagcgcgcgccgcaagcagcgggtgcgcacgcgggtccgg
aagctggggcaggggcgtccgcgcctgtcggtgttccgttccagccagcacatctacgcc
caggtcatcgacgacgtggcgggccagaccaaggccgcggcttcgtccatcgacaagacc
ctgcgtgcggagctgaagactggcgccgacatcgaagcagccaaggccgtcggcaagctg
atcgccgagcgggccaaggaagccggcatcacggaagtggtgttcgatcgcggttcgtac
ctgttccatggccgggtcaaggccctggccgacgccgcgcgcgaagccggcctgcagttc
taa
DBGET
integrated database retrieval system